DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12895 and CG14757

DIOPT Version :9

Sequence 1:NP_001260868.1 Gene:CG12895 / 36103 FlyBaseID:FBgn0033523 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_610363.1 Gene:CG14757 / 35797 FlyBaseID:FBgn0033274 Length:163 Species:Drosophila melanogaster


Alignment Length:159 Identity:105/159 - (66%)
Similarity:124/159 - (77%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RRLQLPM-------MAQSRLASNLDKTEYTTP-------GEIVDYDDPPHLPVPEYPVRPDEPLE 62
            |:|:|.|       :...|..||:..:....|       ..||||:||.:||:|||||||:||||
  Fly     3 RQLRLTMDISGWIFLPWRRSMSNMKDSPPPPPPLASTFNDVIVDYEDPDYLPLPEYPVRPNEPLE 67

  Fly    63 TRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFYWATDTKPTP 127
            |||||||||||||||||||||||||.||||::|:|||||:||||||||||||||:||||:.||||
  Fly    68 TRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWDIYYWATEVKPTP 132

  Fly   128 PQFDTEIMRLLKEHVKNHEKVQRIRQPDL 156
            .::|||||.||||||||.|:|.|:|||||
  Fly   133 KEYDTEIMGLLKEHVKNAERVTRLRQPDL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12895NP_001260868.1 Sdh5 65..138 CDD:281870 60/72 (83%)
CG14757NP_610363.1 Sdh5 70..143 CDD:281870 60/72 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441199
Domainoid 1 1.000 97 1.000 Domainoid score I7199
eggNOG 1 0.900 - - E1_COG2938
Homologene 1 1.000 - - H32370
Inparanoid 1 1.050 126 1.000 Inparanoid score I4670
Isobase 1 0.950 - 0 Normalized mean entropy S1158
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492851at2759
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm24586
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - P PTHR12469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1299
SonicParanoid 1 1.000 - - X3172
1413.780

Return to query results.
Submit another query.