DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12895 and Y57A10A.29

DIOPT Version :9

Sequence 1:NP_001260868.1 Gene:CG12895 / 36103 FlyBaseID:FBgn0033523 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_496607.1 Gene:Y57A10A.29 / 174870 WormBaseID:WBGene00013269 Length:119 Species:Caenorhabditis elegans


Alignment Length:94 Identity:37/94 - (39%)
Similarity:62/94 - (65%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFYWAT 121
            |.|.::.::.||||||:|||:||||:||..|..::||..:..:...||:||||...:||:||:.:
 Worm    25 PGEKIDAKRARLLYQSKKRGILENDILLGDFAEQNLKKMSEPELKAYDKLINGEHMEWDLFYYLS 89

  Fly   122 DTKPTPPQFDTEIMRLLKEHVKNHEKVQR 150
            : |.:||: |.|..::       ::||::
 Worm    90 N-KKSPPE-DVESCQV-------YQKVKK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12895NP_001260868.1 Sdh5 65..138 CDD:281870 33/72 (46%)
Y57A10A.29NP_496607.1 Sdh5 33..106 CDD:281870 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157429
Domainoid 1 1.000 71 1.000 Domainoid score I6147
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I3843
Isobase 1 0.950 - 0 Normalized mean entropy S1158
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492851at2759
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm14379
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - O PTHR12469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1299
SonicParanoid 1 1.000 - - X3172
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.