DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12895 and sdhaf2

DIOPT Version :9

Sequence 1:NP_001260868.1 Gene:CG12895 / 36103 FlyBaseID:FBgn0033523 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_017948808.1 Gene:sdhaf2 / 100497541 XenbaseID:XB-GENE-990420 Length:153 Species:Xenopus tropicalis


Alignment Length:124 Identity:58/124 - (46%)
Similarity:82/124 - (66%) Gaps:6/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GEIVD----YDDPPHLPVPEYPVRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNA 97
            |::.|    |:.  .:.:|.:..|.:|..|.::.||:|:|||||||||.:|||.|..|:|.....
 Frog    24 GQVSDATGTYES--EIQLPPWKERLNETPEIKRARLVYESRKRGMLENCILLSLFAKKYLSSMTD 86

  Fly    98 EQTAEYDQLINGVSNDWDIFYWATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRIRQPDL 156
            .|.::||:|||..|||||::||||..:.||.:|:.|:|.||||..||.:..||:|||||
 Frog    87 TQLSQYDRLINMPSNDWDLYYWATGAQETPKEFNNEVMDLLKEFAKNKDMEQRLRQPDL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12895NP_001260868.1 Sdh5 65..138 CDD:281870 38/72 (53%)
sdhaf2XP_017948808.1 Sdh5 54..127 CDD:377166 38/72 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7345
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32370
Inparanoid 1 1.050 127 1.000 Inparanoid score I4535
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492851at2759
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm48024
Panther 1 1.100 - - O PTHR12469
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.