DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanBPM and SSH4

DIOPT Version :9

Sequence 1:NP_001303342.1 Gene:RanBPM / 36102 FlyBaseID:FBgn0262114 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_012798.1 Gene:SSH4 / 853735 SGDID:S000001607 Length:579 Species:Saccharomyces cerevisiae


Alignment Length:471 Identity:98/471 - (20%)
Similarity:161/471 - (34%) Gaps:130/471 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 LYPNVNESETPLPRCWSPHDKCLSIGLSQNNLRVTYKGVGKQHSDAASVRTAYPIP-SSCGLYYF 470
            |.|::|::       ...:...|...:.|:.|.:.:....|..|...:    ||:| :.....||
Yeast   180 LLPSINDN-------IDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMN----YPLPHNRKDAVYF 233

  Fly   471 EVRI---ISKGRNGYMGIGLTAQQFRMNRLPGWDKQSYGYHGDD----GNSFSSSGNGQTYGPTF 528
            ||:|   |.|. |....||||...:...|:||..|.|..|....    .|.|::|    |..|..
Yeast   234 EVKIFRHIQKS-NSIFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRINNPFTAS----TLLPKL 293

  Fly   529 TTGDVIGCCVNFVNNTCFYTKN-----------GVDLGI---AFRDLPTKLYPTVGLQTPGEEVD 579
            ..||.:|....:...|.|.|.|           |:||.|   ||....|:.|...||.   |:.|
Yeast   294 EEGDTVGFGYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIGAFNAAYTRTYTRDGLL---EDPD 355

  Fly   580 ANFGQEPFKFDKIVDMMK-------------EMRSNVLRKIDRYPHLLETPENLMNRLVSTYLVH 631
            ....:|.....|.:::.|             ||.|:   :::.:.:|.:.....:...|..|...
Yeast   356 NVSFREALSEGKDIEVAKDLQRVHDPHDESDEMTSD---EVELHVNLGQVGFVFIEANVKKYAFG 417

  Fly   632 NAFSKTA--EAFNGYTNQTFNEDLASIKTRQKIIKLILTGKMSQAIEHTLRSFPGLLENNKNLWF 694
            :.:.:..  .|:||              |..|...::..|:          ..|....:..|.:.
Yeast   418 SVYGQIGIPPAYNG--------------TEIKKDTILQKGE----------ELPPRYADTDNFFG 458

  Fly   695 ALKCRQFIEMINGADIENVNNKVTATTQTMPTNQTSVIQSTKTFKHSKS---------------- 743
            ::|.:           |..::::||.|       :..:.|..|::...|                
Yeast   459 SMKVK-----------EGSSSRITAQT-------SKPLWSVGTYERISSNFDRENNVYHDSLETD 505

  Fly   744 -GSGNGNVNINQTQQQNNTAIPAVIKPQGGDRPDIKNM---LVDDNSNKCVEHDSNSMDVEMEPC 804
             .:.:.|||.|......|...| :::..|..||:..|.   :.|...||...:.|..        
Yeast   506 DNNTDNNVNNNDENAGCNENSP-LLEDDGNKRPENSNTPREVSDGAINKNPRNKSTK-------- 561

  Fly   805 QSHSNGGDSSSNGNAS 820
            :...|.|.||...|.|
Yeast   562 KRQRNRGKSSKKKNRS 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanBPMNP_001303342.1 Extensin_2 55..103 CDD:252669
Involucrin2 137..188 CDD:284425
SPRY_RanBP9_10 442..584 CDD:293966 47/163 (29%)
CLTH 655..938 CDD:287564 33/186 (18%)
CTLH 655..711 CDD:128914 6/55 (11%)
CRA 846..944 CDD:214806
SSH4NP_012798.1 SPRY 199..341 CDD:413402 43/150 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I3211
eggNOG 1 0.900 - - E1_KOG1477
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12864
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.