DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanBPM and AT4G09310

DIOPT Version :9

Sequence 1:NP_001303342.1 Gene:RanBPM / 36102 FlyBaseID:FBgn0262114 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_192669.2 Gene:AT4G09310 / 826514 AraportID:AT4G09310 Length:397 Species:Arabidopsis thaliana


Alignment Length:300 Identity:86/300 - (28%)
Similarity:148/300 - (49%) Gaps:28/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 SIGLSQNNLRVTYKGVGKQHS----DAASVRTAYPIPSSCGLYYFEVRIISKGRNGYMGIGLTAQ 490
            ::|.|.....|:..|:..|::    |...::|..|.|::|..|||||.|::.|..|.:.||.:.:
plant    17 TVGGSDEFTFVSPDGLSGQYTGPDHDGVVLQTENPAPTNCLAYYFEVHIMNAGEKGEIAIGFSKE 81

  Fly   491 QFRMNRLPGWDKQSYGYHGDDGNSFSSSGNGQ----TYGPTFTTGDVIGCCVNFVNNTCFYTKNG 551
            .....   |:..:|..|.|:.|...|.:|:|.    ....|:||||::||.::.|:...|:||||
plant    82 HIYSE---GYTVRSCAYIGNSGLICSQNGDGDRTVAKASDTYTTGDLVGCGIDSVSQEFFFTKNG 143

  Fly   552 VDLGIAFRDLPTKLYPTVGLQTPGEEVDANF-GQEPFKFDKIVDMMKEMRSNVLRKIDRYPHLLE 615
            ..:|...|.....:|||:.|.:..|.|..|| ||..|.|| .....:.:|....|:|::    :.
plant   144 TIVGTIPRQFRRPVYPTIVLHSQNEAVTVNFGGQIAFSFD-FEHFEESLRVKKEREIEK----IS 203

  Fly   616 TPENLMNRLVSTYLVHNAFSKTAEAFNGYTNQ--------TFNEDLASIKTRQKIIKLILTGKMS 672
            ...::.:.||.|||:...:..:..|||...::        :|:|  ..:..|:|:.:||:|.::.
plant   204 MSRSISHGLVKTYLLRYGYEDSFRAFNLAASRHTVIAQENSFDE--YELHQRKKLRELIMTAEID 266

  Fly   673 QAIEHTLRSFPGLLENNKNLWFALKCRQFIEMI-NGADIE 711
            .||......:|.|:|.....:|.|.|::.:|:: .||..|
plant   267 DAIAALKDRYPQLIEGGSEAYFLLICQKIVELVRKGAIAE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanBPMNP_001303342.1 Extensin_2 55..103 CDD:252669
Involucrin2 137..188 CDD:284425
SPRY_RanBP9_10 442..584 CDD:293966 48/150 (32%)
CLTH 655..938 CDD:287564 16/57 (28%)
CTLH 655..711 CDD:128914 16/56 (29%)
CRA 846..944 CDD:214806
AT4G09310NP_192669.2 SPRY_RanBP_like 44..175 CDD:293943 44/133 (33%)
CTLH 252..306 CDD:128914 16/53 (30%)
CRA 302..397 CDD:214806 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3302
eggNOG 1 0.900 - - E1_KOG1477
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I1282
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106989at2759
OrthoFinder 1 1.000 - - FOG0001704
OrthoInspector 1 1.000 - - otm2683
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1611
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.