DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanBPM and CG6617

DIOPT Version :9

Sequence 1:NP_001303342.1 Gene:RanBPM / 36102 FlyBaseID:FBgn0262114 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_573315.1 Gene:CG6617 / 32852 FlyBaseID:FBgn0030944 Length:225 Species:Drosophila melanogaster


Alignment Length:322 Identity:59/322 - (18%)
Similarity:96/322 - (29%) Gaps:149/322 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 LRKIDRYPHLLETPENLMNRLVSTYLVHNAFSKTAEAFNGYTNQTFNEDLASIKTRQKIIKLILT 668
            |::::::|.    .:..||||:..|||...|.:.||.|....:...:.:|:|:..|..|.:.:..
  Fly    16 LQRLEQFPF----KQADMNRLIMNYLVTEGFKEAAEKFQHEADLEPSVELSSLDGRILIREAVQA 76

  Fly   669 GKMSQAIEHTLRSFPGLLENNKNLWFALKCRQFIEMINGADIENVNNKVTATTQTMPTNQTSVIQ 733
            |::.:|.:...:..|.||.:::.|:|.|:..|.||:|....:|..               .|..|
  Fly    77 GRIEEATQLVNQLHPELLGSDRYLFFHLQQLQLIELIRAGKVEEA---------------LSFAQ 126

  Fly   734 STKTFKHSKSGSGNGNVNINQTQQQNNTAIPAVIKPQGGDRPDIKNMLVDDNSNKCVEHDSNSMD 798
            |    |.|:||                                                      
  Fly   127 S----KLSESG------------------------------------------------------ 133

  Fly   799 VEMEPCQSHSNGGDSSSNGNASAVRNSLDAIDEEMDVSPSSRNCGRVIEKILEFGKELSSMGQQL 863
                                                                             
  Fly   134 ----------------------------------------------------------------- 133

  Fly   864 EKENLMTEEERQMLEDAFSLIAYSNPWSSPLGWLLCPSRRESVSTTLNSAILESLNFERRPP 925
              |..|.|.||.:     :|:|:..|..||...||..|.|:.:::.||||||.....|...|
  Fly   134 --EEAMFELERTL-----ALLAFEKPQESPFADLLEQSYRQKIASELNSAILRCEQSEDSTP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanBPMNP_001303342.1 Extensin_2 55..103 CDD:252669
Involucrin2 137..188 CDD:284425
SPRY_RanBP9_10 442..584 CDD:293966
CLTH 655..938 CDD:287564 45/271 (17%)
CTLH 655..711 CDD:128914 15/55 (27%)
CRA 846..944 CDD:214806 22/80 (28%)
CG6617NP_573315.1 LisH 28..52 CDD:369916 11/23 (48%)
CLTH 67..205 CDD:402305 44/267 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12864
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.