DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanBPM and Spryd3

DIOPT Version :9

Sequence 1:NP_001303342.1 Gene:RanBPM / 36102 FlyBaseID:FBgn0262114 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_001028449.2 Gene:Spryd3 / 223918 MGIID:2446175 Length:442 Species:Mus musculus


Alignment Length:381 Identity:80/381 - (20%)
Similarity:136/381 - (35%) Gaps:124/381 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 EVASV-SGAQRLHSVAVLPRYSSASRAPRSSNNNNNNISNHNNNNNNSNSNSLSRR--------- 347
            ||:.| ||.:...:|.::|:|.|....|   ....::::.|.::....|..:..|:         
Mouse    82 EVSIVDSGVRGTIAVGLVPQYYSLDHQP---GWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGD 143

  Fly   348 ---------------TRHFYSNNGSHFSNDMFPSHNPRSSTQTSSPRVGGRRHHSTPAASSNSPQ 397
                           .:.|::.||....:.:.|     .|.....|.||               .
Mouse   144 RIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMP-----MSPDGLFPAVG---------------M 188

  Fly   398 HQGVDPLRL-LYPNVNESETPLPRCWSPHDKCLSIGLSQNNLRV-----TYKGVGKQHSDAASVR 456
            |...:.:|| |...:...:..:....|..|:...:    :::||     .|.|.||...|....:
Mouse   189 HSLGEEVRLHLNAELGREDDSVMMVDSYEDEWGRL----HDVRVCGTLLEYLGKGKSIVDVGLAQ 249

  Fly   457 TAYPIPSSCGLYYFEVRIISKGRNGYMGIGLTAQQFRMNRLPGWDKQSYGYHGDDGNSFSSSGNG 521
            ..:|:  |...:||||.|:..|...|:.:||..:.:..||.|||.:.|..||.|||..|..||.|
Mouse   250 ARHPL--STRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHADDGKIFHGSGVG 312

  Fly   522 QTYGPTFTTGDVIGCCVNF-----------VNNTC------------------------------ 545
            ..:||....||::||.:.|           .:::|                              
Mouse   313 DPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVRNVRNVMYLHQEGEEEEE 377

  Fly   546 ----------------------FYTKNGVDLGIAFRDLPT-KLYPTVGLQTPGEEV 578
                                  |:|:||..:|.....:|: ..:||:|:.:.||:|
Mouse   378 EEEEEEDGEEIEQEHEGKKVVVFFTRNGKIIGKKDAVVPSGGFFPTIGMLSCGEKV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanBPMNP_001303342.1 Extensin_2 55..103 CDD:252669
Involucrin2 137..188 CDD:284425
SPRY_RanBP9_10 442..584 CDD:293966 51/201 (25%)
CLTH 655..938 CDD:287564
CTLH 655..711 CDD:128914
CRA 846..944 CDD:214806
Spryd3NP_001028449.2 SPRYD3 43..200 CDD:293965 24/140 (17%)
SPRYD3 220..438 CDD:293965 53/220 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1477
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106989at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.