DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RanBPM and spryd3

DIOPT Version :9

Sequence 1:NP_001303342.1 Gene:RanBPM / 36102 FlyBaseID:FBgn0262114 Length:1127 Species:Drosophila melanogaster
Sequence 2:NP_001099164.1 Gene:spryd3 / 100005036 ZFINID:ZDB-GENE-070928-22 Length:416 Species:Danio rerio


Alignment Length:162 Identity:57/162 - (35%)
Similarity:86/162 - (53%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 QNNLRVTYKGVGKQHSDAASVRTAYPIPSSCGLYYFEVRIISKGRNGYMGIGLTAQQFRMNRLPG 499
            :|...::|:|    :||......| |.|.|.|..||||.|:..|..|.:.:||..|.::::..||
Zfish    37 KNGDTLSYQG----NSDEVGCYVA-PRPLSKGNCYFEVTIMDTGVRGTIAVGLVPQYYKLDYQPG 96

  Fly   500 WDKQSYGYHGDDGNSFSSSGNGQTYGPTFTTGDVIGCCVNFVNN------TCFYTKNGVDLG-IA 557
            |..||..||.|||..::.:..||.:||....||.|||.: :.::      |.|:||||.::| :.
Zfish    97 WLPQSIAYHADDGKLYNGNPVGQQFGPKCNRGDRIGCGI-YADSFDAGLVTVFFTKNGKEVGSVV 160

  Fly   558 FRDLPTKLYPTVGLQTPGEEV----DANFGQE 585
            ....|..|:|.:|:.:.||||    .|.:|.|
Zfish   161 VPVAPDGLFPAIGMHSLGEEVRLDLQAEWGSE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanBPMNP_001303342.1 Extensin_2 55..103 CDD:252669
Involucrin2 137..188 CDD:284425
SPRY_RanBP9_10 442..584 CDD:293966 54/152 (36%)
CLTH 655..938 CDD:287564
CTLH 655..711 CDD:128914
CRA 846..944 CDD:214806
spryd3NP_001099164.1 SPRYD3 29..186 CDD:293965 54/154 (35%)
SPRYD3 207..412 CDD:293965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106989at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.