DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and PMD1

DIOPT Version :10

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_011058.3 Gene:PMD1 / 856869 SGDID:S000000934 Length:1753 Species:Saccharomyces cerevisiae


Alignment Length:122 Identity:26/122 - (21%)
Similarity:43/122 - (35%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LGMLDEEQKKDPEVGKTIRALFIISPD-HKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVA 172
            :..:|:|.:   |.||.|.|....||. .:....:..|:....|....|:...|..:::..:..:
Yeast  1591 ISQMDDEMR---ETGKPIFARGSSSPTLSRQHSDVATPLKQQENTRPALKFASSSPISEGFRKSS 1652

  Fly   173 TPANWTPGTKVMILPSVTDDEA-----------------HKLFPKGFDKVSMPSGVN 212
            ...:..|.|::....||||..|                 |.......:...|||.||
Yeast  1653 IKFSQAPSTQISPRTSVTDFTASQQRRQHMNKRFSTQTTHSTSALFMNPAFMPSAVN 1709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 PRX_1cys 3..218 CDD:239314 26/122 (21%)
PMD1NP_011058.3 Kelch_6 132..188 CDD:404790
KELCH repeat 132..184 CDD:276965
KELCH repeat 188..235 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.