DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and Prdx4

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_017457660.1 Gene:Prdx4 / 85274 RGDID:620043 Length:282 Species:Rattus norvegicus


Alignment Length:186 Identity:54/186 - (29%)
Similarity:85/186 - (45%) Gaps:31/186 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVNDIK 83
            :|..:::| .::|.|.:|.|||.||.||:........||...||:.:|.|||:..:|:.|:|   
  Rat   111 LKLTDYRG-KYLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWIN--- 171

  Fly    84 SYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSM 142
                 .|      |....|:::|....::...|:..|:.      |.|:|.||||.....:|...
  Rat   172 -----TPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDS------GHTLRGLFIIDDKGVLRQIT 225

  Fly   143 FYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANW---------TPGTKVMIL-PS 188
            ...:..||:|||.||.:.:.|.||:.......::|         ...|.||:| ||
  Rat   226 LNDLPVGRSVDETLRLVQAFQYTDKHGEDNPRSSWKTEVFRQAKLKSTSVMMLRPS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 54/186 (29%)
PRX_1cys 3..218 CDD:239314 54/186 (29%)
Prdx4XP_017457660.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.