DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and TSA2

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_010741.1 Gene:TSA2 / 852064 SGDID:S000002861 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:57/183 - (31%)
Similarity:85/183 - (46%) Gaps:23/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVNDIK 83
            |...:::| .:|||...|..|:.||.||:...:....:|..:..:.|..|.|:..|.:.|.|   
Yeast    25 ISLEKYKG-KYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVLFASTDSEYSLLAWTN--- 85

  Fly    84 SYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSM 142
                 :|      |....|::||....|:...|:|.|::      |..:|.||||.|...:|...
Yeast    86 -----LPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKE------GIALRGLFIIDPKGIIRHIT 139

  Fly   143 FYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSVTDDEAH 195
            ...:|.||||:|.||.::..|.||:...| .|.|||||. ..|.|.|.|.:.:
Yeast   140 INDLSVGRNVNEALRLVEGFQWTDKNGTV-LPCNWTPGA-ATIKPDVKDSKEY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 57/180 (32%)
PRX_1cys 3..218 CDD:239314 57/183 (31%)
TSA2NP_010741.1 PRX_Typ2cys 5..176 CDD:239313 51/166 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.