DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and Prdx3

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_071985.2 Gene:Prdx3 / 64371 RGDID:620040 Length:257 Species:Rattus norvegicus


Alignment Length:211 Identity:63/211 - (29%)
Similarity:99/211 - (46%) Gaps:33/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QTVPNFEAD-TTKGPIK---FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCL 65
            |..|:|:.. ...|..|   ..:::| .::|||.:|.|||.||.||:...:....||...|.:.:
  Rat    68 QHAPHFKGTAVVNGEFKELSLDDFKG-KYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVV 131

  Fly    66 AHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGK 124
            |.|||:..||:.|:|        .|      |.....:::|.|:.::...|:|.|      ..|.
  Rat   132 AVSVDSHFSHLAWIN--------TPRKNGGLGHMNITLLSDLTKQISRDYGVLLE------SAGI 182

  Fly   125 TIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSV 189
            .:|.||||.|:..::......:..||:|:|.||.:.:.|..:....|. ||||||.:.. |.||.
  Rat   183 ALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVC-PANWTPESPT-IKPSP 245

  Fly   190 TDDEAHKLFPKGFDKV 205
            |..:.:      |:||
  Rat   246 TASKEY------FEKV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 60/198 (30%)
PRX_1cys 3..218 CDD:239314 63/211 (30%)
Prdx3NP_071985.2 PRX_Typ2cys 66..236 CDD:239313 54/183 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.