DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and prdx1

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001013489.2 Gene:prdx1 / 541344 ZFINID:ZDB-GENE-050320-35 Length:199 Species:Danio rerio


Alignment Length:209 Identity:65/209 - (31%)
Similarity:98/209 - (46%) Gaps:30/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGQTVPNFEA-----DTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNT 62
            :|:..|:|.|     |...|.::..:::| .:||||.:|.|||.||.||:...:....||.|.|.
Zfish     8 IGKPAPDFTAKAVMPDGQFGDVRLSDYKG-KYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKINC 71

  Fly    63 KCLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPE 121
            :.:..|||:...|:.|..        .|      |....|::||..|.::...|:|.|::     
Zfish    72 EIIGASVDSHFCHLAWTK--------TPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDE----- 123

  Fly   122 VGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMIL 186
             |...|.||||.....:|......:..||::||.||.:.:.|.||:...|. ||.|.|| |..|.
Zfish   124 -GIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQFTDKHGEVC-PAGWKPG-KDTIK 185

  Fly   187 PSVTDDEAHKLFPK 200
            |.|  :::...|.|
Zfish   186 PDV--NQSKDFFSK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 63/201 (31%)
PRX_1cys 3..218 CDD:239314 65/209 (31%)
prdx1NP_001013489.2 PTZ00253 1..199 CDD:140280 65/209 (31%)
PRX_Typ2cys 8..180 CDD:239313 57/187 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578644
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.