DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and CG6888

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster


Alignment Length:211 Identity:69/211 - (32%)
Similarity:97/211 - (45%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLGQTVPNFEADTTKGPIK-------FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFA 58
            :.:.|..|||   ||...:.       ..:.:|. :|:|..:||||:.||.|||...:...||| 
  Fly     4 LNINQVAPNF---TTNAVVSGGYRNFALTDLRGR-YVLLVFYPADFSYVCPTELQAFSDRAPEF- 63

  Fly    59 KRNTKC--LAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEE 115
             ||..|  ||.|.|:...|..|:|        .|      |:...|::||....:|...|:||| 
  Fly    64 -RNVGCEVLACSTDSHFVHCAWMN--------TPRKNGGLGELDIPLLADKNMKIARDYGVLDE- 118

  Fly   116 QKKDPEVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPG 180
                 :.|..:||||||..:.::|......|..||:|||.||.:.:.|.:|....|. |.||.||
  Fly   119 -----DTGLALRALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVC-PVNWRPG 177

  Fly   181 TKVMILPSVTDDEAHK 196
            .|.|...:...:|..|
  Fly   178 AKTMKADATGKEEYFK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 67/207 (32%)
PRX_1cys 3..218 CDD:239314 69/209 (33%)
CG6888NP_648759.1 AhpC 3..194 CDD:223527 69/211 (33%)
PRX_Typ2cys 6..177 CDD:239313 63/191 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.