DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and prdx2

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_989001.1 Gene:prdx2 / 394597 XenbaseID:XB-GENE-945852 Length:206 Species:Xenopus tropicalis


Alignment Length:210 Identity:68/210 - (32%)
Similarity:102/210 - (48%) Gaps:29/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGQTVPNFEADTTKG----PIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTK 63
            :||..|.|:|.....    .|:..::.| .:||||.:|.|||.||.||:...:.|..:|:|.|.:
 Frog    16 IGQPAPAFKATAVVNGEFKDIQLSDYLG-KYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQ 79

  Fly    64 CLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPEV 122
            .:|.|||:..:|:.|.|        :|      |....|:::|.|..:|...|:|.||.      
 Frog    80 LIAVSVDSQFTHLAWTN--------VPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEED------ 130

  Fly   123 GKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILP 187
            |...|.||||.....:|......:..||:|:|.||.:.:.|.||:...|. ||.|.||:.. |.|
 Frog   131 GVAYRGLFIIDGKGNLRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVC-PAGWKPGSST-IKP 193

  Fly   188 SVTDDEAHKLFPKGF 202
            :|.|.:  :.|.|.:
 Frog   194 NVKDSK--EFFSKEY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 66/200 (33%)
PRX_1cys 3..218 CDD:239314 68/210 (32%)
prdx2NP_989001.1 PRX_Typ2cys 16..187 CDD:239313 60/186 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.