DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and prdx3

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001013478.3 Gene:prdx3 / 373079 ZFINID:ZDB-GENE-030826-18 Length:250 Species:Danio rerio


Alignment Length:203 Identity:64/203 - (31%)
Similarity:98/203 - (48%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QTVPNFEADTT-KGPIK---FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCL 65
            |..|:|:.... .|..|   ..:::| .::|||.:|.|||.||.||:...:....||...|...:
Zfish    62 QAAPHFKGTAVINGEFKEISLGDFKG-KYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCAVV 125

  Fly    66 AHSVDALNSHVDWVN-DIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRAL 129
            ..|||:..:|:.|.| ..||..|   |....|::||.|:.::...|:|.|..      |..:|.|
Zfish   126 GVSVDSHFTHLAWTNTPRKSGGL---GKIQIPLLADLTKQVSRDYGVLLEGP------GIALRGL 181

  Fly   130 FIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSV--TDD 192
            |||.|:..||......:..||:|:|.||.:.:.|..:....|. ||:|||.:     |::  |.|
Zfish   182 FIIDPNGIVRHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVC-PASWTPKS-----PTIKPTPD 240

  Fly   193 EAHKLFPK 200
            .:.:.|.|
Zfish   241 GSKEYFEK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 62/195 (32%)
PRX_1cys 3..218 CDD:239314 64/203 (32%)
prdx3NP_001013478.3 PRX_Typ2cys 60..230 CDD:239313 57/178 (32%)
PTZ00253 64..250 CDD:140280 63/201 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.