DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and Prdx2

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_058865.2 Gene:Prdx2 / 29338 RGDID:3838 Length:198 Species:Rattus norvegicus


Alignment Length:208 Identity:68/208 - (32%)
Similarity:101/208 - (48%) Gaps:29/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGQTVPNFEA----DTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTK 63
            :|:..|:|.|    |.....||..:::| .:||||.:|.|||.||.||:...:.|..:|.|...:
  Rat     8 IGKPAPDFTATAVVDGAFKEIKLSDYRG-KYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCE 71

  Fly    64 CLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPEV 122
            .|..|||:..:|:.|:|        .|      |....|::||.|:.|:...|:|..::      
  Rat    72 VLGVSVDSQFTHLAWIN--------TPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDE------ 122

  Fly   123 GKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILP 187
            |...|.||||.....:|......:..||:|||.||.:.:.|.||....|. ||.|.||:.. |.|
  Rat   123 GIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVC-PAGWKPGSDT-IKP 185

  Fly   188 SVTDDEAHKLFPK 200
            :|  |::.:.|.|
  Rat   186 NV--DDSKEYFSK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 66/200 (33%)
PRX_1cys 3..218 CDD:239314 68/208 (33%)
Prdx2NP_058865.2 PRX_Typ2cys 8..179 CDD:239313 60/186 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339070
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.