DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and ral2

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_596339.1 Gene:ral2 / 2540760 PomBaseID:SPBC21.05c Length:611 Species:Schizosaccharomyces pombe


Alignment Length:102 Identity:25/102 - (24%)
Similarity:39/102 - (38%) Gaps:28/102 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EWQGNSW-VVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVNDIKSYC 86
            |:|||.. :..:.|..|.........|.:..:.      :||||         :|  :|||..|.
pombe    75 EYQGNQKPIPRYFHSGDLWNNKLIFFGGMGFND------DTKCL---------YV--LNDIDIYD 122

  Fly    87 LD------IPGDFPYPIIADPTRDLAVTLGMLDEEQK 117
            ::      |||    .|..:.|.|.|..:...|.::|
pombe   123 IETKQWSHIPG----MITENQTNDDAKEVNGSDVDEK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 25/102 (25%)
PRX_1cys 3..218 CDD:239314 25/102 (25%)
ral2NP_596339.1 KELCH repeat 36..81 CDD:276965 4/5 (80%)
Kelch_3 41..89 CDD:290151 4/13 (31%)
Kelch_6 84..136 CDD:290672 15/72 (21%)
KELCH repeat 85..161 CDD:276965 21/92 (23%)
KELCH repeat 164..206 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43503
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.