DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and Prdx1

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_035164.1 Gene:Prdx1 / 18477 MGIID:99523 Length:199 Species:Mus musculus


Alignment Length:204 Identity:68/204 - (33%)
Similarity:101/204 - (49%) Gaps:18/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLGQTVPNFEA-----DTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRN 61
            ::|...|||:|     |.....|...|::| .:||.|.:|.|||.||.||:...:....||.|.|
Mouse     7 KIGYPAPNFKATAVMPDGQFKDISLSEYKG-KYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLN 70

  Fly    62 TKCLAHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTI 126
            .:.:..|||:...|:.|:|..|..  ...|....|:|:||.|.:|...|:|..::      |.:.
Mouse    71 CQVIGASVDSHFCHLAWINTPKKQ--GGLGPMNIPLISDPKRTIAQDYGVLKADE------GISF 127

  Fly   127 RALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSVTD 191
            |.||||.....:|......:..||:||||:|.:.:.|.||:...|. ||.|.||:.. |.|.|  
Mouse   128 RGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVC-PAGWKPGSDT-IKPDV-- 188

  Fly   192 DEAHKLFPK 200
            :::.:.|.|
Mouse   189 NKSKEYFSK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 66/196 (34%)
PRX_1cys 3..218 CDD:239314 68/203 (33%)
Prdx1NP_035164.1 PRX_Typ2cys 8..180 CDD:239313 61/181 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835441
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.