DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and prdx-6

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_741287.1 Gene:prdx-6 / 176837 WormBaseID:WBGene00021401 Length:231 Species:Caenorhabditis elegans


Alignment Length:226 Identity:93/226 - (41%)
Similarity:128/226 - (56%) Gaps:10/226 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLGQTVPN--FEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTK 63
            |:||.||||  ||.|..|.. ..|.:.|..|::||||||||||||||||..:....|||.||:.:
 Worm     1 MKLGDTVPNFTFETDLRKNQ-TLHNYIGEQWLMLFSHPADFTPVCTTELAELVKLAPEFRKRHVQ 64

  Fly    64 CLAHSVDALNSHVDWVNDIKSYC--LDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTI 126
            .||.|:|:..:|.||..||.|..  .:.....|:.||||..|.:...|||:|.::.....:..:.
 Worm    65 ILAISIDSSETHRDWAKDINSVAQLSNCGSHLPFEIIADTDRSICTELGMIDPDEMNSEGICLSA 129

  Fly   127 RALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSVTD 191
            ||:.:..||.|::..:.||.:.|||..||||.:|.:||..:.. |||||||..|..|:..||::.
 Worm   130 RAVMLFGPDKKLKSKILYPATFGRNFVEILRMVDGVQLGTKAP-VATPANWIAGDNVIAQPSLSQ 193

  Fly   192 DEA-HKLFPKGFDK---VSMPSGVNYVRTTE 218
            :.. .:|.....||   |.:|||.:|:|..|
 Worm   194 ERVIQELCGGDPDKCKTVPLPSGKSYLRVIE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 83/196 (42%)
PRX_1cys 3..218 CDD:239314 91/222 (41%)
prdx-6NP_741287.1 PRX_1cys 3..221 CDD:239314 90/219 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158550
Domainoid 1 1.000 124 1.000 Domainoid score I3407
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I2532
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60653
OrthoDB 1 1.010 - - D1129256at2759
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 1 1.000 - - otm14762
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - O PTHR43503
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2241
SonicParanoid 1 1.000 - - X1721
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.