DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and prdx-3

DIOPT Version :9

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_497892.1 Gene:prdx-3 / 175573 WormBaseID:WBGene00011110 Length:226 Species:Caenorhabditis elegans


Alignment Length:211 Identity:66/211 - (31%)
Similarity:100/211 - (47%) Gaps:33/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TVPNFEAD-TTKGPIKF---HEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLA 66
            |||.|:.. ...|..|.   .:::| .|:|:|.:|.|||.||.||:........||.....:.:|
 Worm    38 TVPAFKGTAVVDGDFKVISDQDYKG-KWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVA 101

  Fly    67 HSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKT 125
            .|.|:..||:.|||        .|      ||...|::||..:.:|.:.|:||:|.      |.:
 Worm   102 CSCDSHFSHLAWVN--------TPRKDGGLGDMDIPLLADFNKKIADSFGVLDKES------GLS 152

  Fly   126 IRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSVT 190
            .|.||:|.|...||.:....:..||:|||.||.:.:.|.:|:...|. ||:|...:.. |.|.|.
 Worm   153 YRGLFLIDPSGTVRHTTCNDLPVGRSVDETLRVLKAFQFSDKHGEVC-PADWHEDSPT-IKPGVA 215

  Fly   191 DDEAHKLFPKGFDKVS 206
            ..:.:      |:||:
 Worm   216 TSKEY------FNKVN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 63/197 (32%)
PRX_1cys 3..218 CDD:239314 66/211 (31%)
prdx-3NP_497892.1 PRX_Typ2cys 37..206 CDD:239313 60/183 (33%)
AhpC 38..223 CDD:223527 64/207 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.