DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and RCF1

DIOPT Version :9

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_013682.1 Gene:RCF1 / 854978 SGDID:S000004492 Length:159 Species:Saccharomyces cerevisiae


Alignment Length:93 Identity:23/93 - (24%)
Similarity:39/93 - (41%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSNSLFETD-EDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVA 101
            ||..:.|.| :|:....::....|:.|.:.:|......|.::.|...| .|:...:.:..:.||.
Yeast     6 SSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVR-LGNKWKAQYYFRWRVG 69

  Fly   102 AQGTVVGCLTAG--LAYTMAKEYLLHEE 127
            .|...:..|.||  :..|..||....||
Yeast    70 LQAATLVALVAGSFIYGTSGKELKAKEE 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 63..111 CDD:282450 9/47 (19%)
RCF1NP_013682.1 HIG_1_N 32..81 CDD:398334 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12297
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.960

Return to query results.
Submit another query.