DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and Higd2a

DIOPT Version :9

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_080209.1 Gene:Higd2a / 67044 MGIID:1914294 Length:106 Species:Mus musculus


Alignment Length:67 Identity:25/67 - (37%)
Similarity:36/67 - (53%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTM 118
            |..||.:|:|.:.:|..|..||...|.|.: :||....|..:|:.|:||||..|..:..|||.:.
Mouse    38 KFIRKTRENPMVPIGCLGTAAALTYGLYCF-HRGQSHRSQLMMRTRIAAQGFTVVAILLGLAASA 101

  Fly   119 AK 120
            .|
Mouse   102 MK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 63..111 CDD:282450 17/47 (36%)
Higd2aNP_080209.1 HIG_1_N 47..96 CDD:398334 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.