DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and HIGD1B

DIOPT Version :9

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001258809.1 Gene:HIGD1B / 51751 HGNCID:24318 Length:99 Species:Homo sapiens


Alignment Length:90 Identity:34/90 - (37%)
Similarity:49/90 - (54%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MSSNSLF---ETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQL 98
            ||:|..:   ..|||.. :.||.||.:|||.:.:|:.|.:.......|:.|:|||...|:.|:..
Human     1 MSANRRWWVPPDDEDCV-SEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIHLIHT 64

  Fly    99 RVAAQGTVVGCLTAGLAYTMAKEYL 123
            |||||...||.:..|..|||..:|:
Human    65 RVAAQACAVGAIMLGAVYTMYSDYV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 63..111 CDD:282450 17/47 (36%)
HIGD1BNP_001258809.1 HIG_1_N 29..77 CDD:309642 17/47 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142149
Domainoid 1 1.000 59 1.000 Domainoid score I10674
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5199
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D630066at33208
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - otm40781
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12297
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.