DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and higd1a

DIOPT Version :9

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_956394.1 Gene:higd1a / 373084 ZFINID:ZDB-GENE-030826-15 Length:99 Species:Danio rerio


Alignment Length:82 Identity:36/82 - (43%)
Similarity:53/82 - (64%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVV 107
            :|.:|     :||.||:|::||:..|:|||.|......:|.::||....||.|:.:||||||.||
Zfish     6 YEDNE-----SKLMRKIKQNPFVPAGMAGFFAIVAYRLFKLKSRGDTKMSVHLIHMRVAAQGFVV 65

  Fly   108 GCLTAGLAYTMAKEYLL 124
            |.:|.|:.|:|..||:|
Zfish    66 GAMTLGVIYSMYNEYIL 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 63..111 CDD:282450 22/47 (47%)
higd1aNP_956394.1 HIG_1_N 21..69 CDD:282450 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592313
Domainoid 1 1.000 49 1.000 Domainoid score I11897
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5310
OMA 1 1.010 - - QHG45777
OrthoDB 1 1.010 - - D1581485at2759
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - oto40439
orthoMCL 1 0.900 - - OOG6_106443
Panther 1 1.100 - - O PTHR12297
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5101
SonicParanoid 1 1.000 - - X3099
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.