powered by:
Protein Alignment CG11825 and CG9921
DIOPT Version :9
Sequence 1: | NP_001260865.1 |
Gene: | CG11825 / 36099 |
FlyBaseID: | FBgn0033519 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001259608.1 |
Gene: | CG9921 / 32599 |
FlyBaseID: | FBgn0030743 |
Length: | 102 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 25/64 - (39%) |
Similarity: | 35/64 - (54%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 KLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLAYT 117
||.||:||:|.:.:|.....||...|.|.:|. |:...|..:|:.|:||||..|..|..|:..|
Fly 35 KLQRKIKENPLVPLGCLATTAALTAGLYNFRT-GNRKMSQLMMRSRIAAQGFTVMALVVGVVMT 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45439891 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000673 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12297 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.840 |
|
Return to query results.
Submit another query.