DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and CG9921

DIOPT Version :9

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001259608.1 Gene:CG9921 / 32599 FlyBaseID:FBgn0030743 Length:102 Species:Drosophila melanogaster


Alignment Length:64 Identity:25/64 - (39%)
Similarity:35/64 - (54%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLAYT 117
            ||.||:||:|.:.:|.....||...|.|.:|. |:...|..:|:.|:||||..|..|..|:..|
  Fly    35 KLQRKIKENPLVPLGCLATTAALTAGLYNFRT-GNRKMSQLMMRSRIAAQGFTVMALVVGVVMT 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 63..111 CDD:282450 16/47 (34%)
CG9921NP_001259608.1 HIG_1_N 44..91 CDD:282450 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4431
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12297
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.