powered by:
Protein Alignment CG11825 and Higd2a
DIOPT Version :9
Sequence 1: | NP_001260865.1 |
Gene: | CG11825 / 36099 |
FlyBaseID: | FBgn0033519 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099572.1 |
Gene: | Higd2a / 290999 |
RGDID: | 1309691 |
Length: | 106 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 25/67 - (37%) |
Similarity: | 36/67 - (53%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 KLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTM 118
|..||.:|:|.:.:|..|..||...|.|.: :||....|..:|:.|:||||..|..:..|||.:.
Rat 38 KFIRKTRENPMVPIGCLGTAAALTYGLYCF-HRGQSHRSQLMMRTRIAAQGFTVVAILLGLAAST 101
Fly 119 AK 120
.|
Rat 102 MK 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.