powered by:
Protein Alignment CG11825 and M05D6.5
DIOPT Version :9
Sequence 1: | NP_001260865.1 |
Gene: | CG11825 / 36099 |
FlyBaseID: | FBgn0033519 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254151.1 |
Gene: | M05D6.5 / 174357 |
WormBaseID: | WBGene00010878 |
Length: | 143 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 31/65 - (47%) |
Gaps: | 1/65 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 AQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGL 114
||...:......:|.:::|: |...|.|:|.:|....|....:..:||.|:.||...|..|.||:
Worm 66 AQKTGVVSNAASNPGVILGM-GLTTAALLGMFKSSFLGDKVGAQKMMQYRIMAQFFTVTALVAGV 129
Fly 115 114
Worm 130 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000673 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.