DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and Higd1a

DIOPT Version :9

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_543178.2 Gene:Higd1a / 140937 RGDID:620215 Length:93 Species:Rattus norvegicus


Alignment Length:95 Identity:41/95 - (43%)
Similarity:60/95 - (63%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MSSN---SLFETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQL 98
            ||:|   ||...||  .|.:|..||.:|:||:.:|:|||.|....|.||.::||:...|:.|:.:
  Rat     1 MSTNTDLSLSSYDE--GQGSKFIRKARETPFVPIGMAGFAAIVAYGLYKLKSRGNTKMSIHLIHM 63

  Fly    99 RVAAQGTVVGCLTAGLAYTMAKEYLLHEEP 128
            ||||||.|||.:|.|:.|:|.:|:....:|
  Rat    64 RVAAQGFVVGAMTLGMGYSMYQEFWAKRKP 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 63..111 CDD:282450 23/47 (49%)
Higd1aNP_543178.2 HIG_1_N 28..78 CDD:398334 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335872
Domainoid 1 1.000 57 1.000 Domainoid score I10612
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5150
OMA 1 1.010 - - QHG45777
OrthoDB 1 1.010 - - D1581485at2759
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - otm44918
orthoMCL 1 0.900 - - OOG6_106443
Panther 1 1.100 - - O PTHR12297
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3099
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.