DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and higd1b

DIOPT Version :9

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_002935610.1 Gene:higd1b / 100491892 XenbaseID:XB-GENE-977604 Length:109 Species:Xenopus tropicalis


Alignment Length:103 Identity:43/103 - (41%)
Similarity:54/103 - (52%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVG 108
            |:.|.|  ..||.||:|:||.:.||:|||......|.|:.::||.|..||.|:..|||||..|||
 Frog    11 ESQETV--TGKLQRKMKQSPLVPVGLAGFAVIVAYGLYRLKSRGDMKMSVHLIHTRVAAQACVVG 73

  Fly   109 CLTAGLAYTMAKEY----------LLHEEPKSNTRPDE 136
            ....|..|||.|||          .|.::...||  ||
 Frog    74 ATALGATYTMIKEYRQRWAEERDAALEQQNSRNT--DE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 63..111 CDD:282450 22/47 (47%)
higd1bXP_002935610.1 HIG_1_N 27..78 CDD:368011 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10684
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D630066at33208
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 1 1.000 - - otm47968
Panther 1 1.100 - - O PTHR12297
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3099
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.