DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and TSA1

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_013684.1 Gene:TSA1 / 854980 SGDID:S000004490 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:63/198 - (31%)
Similarity:91/198 - (45%) Gaps:27/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PNFE----ADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHS 68
            |.|:    .|.....:...:::| .:|||...|..||.||.||:...:....:|.::..:.|..|
Yeast    10 PTFKKTAVVDGVFDEVSLDKYKG-KYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFAS 73

  Fly    69 VDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVSLGMLDEEQKKDPEVGKTIR 127
            .|:..|.:.|.|        ||      |....|::||....|:...|:|.||:      |..:|
Yeast    74 TDSEYSLLAWTN--------IPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEE------GVALR 124

  Fly   128 ALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTDE 192
            .||||.|...:|......:..||||||.||.:::.|.||:...| .|.|||||. ..|.|||.|.
Yeast   125 GLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTV-LPCNWTPGA-ATIKPTVEDS 187

  Fly   193 EAH 195
            :.:
Yeast   188 KEY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 63/195 (32%)
PRX_1cys 3..218 CDD:239314 63/198 (32%)
TSA1NP_013684.1 PRX_Typ2cys 5..176 CDD:239313 56/181 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.