DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and 2-Cys Prx B

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_568166.1 Gene:2-Cys Prx B / 830517 AraportID:AT5G06290 Length:273 Species:Arabidopsis thaliana


Alignment Length:187 Identity:69/187 - (36%)
Similarity:100/187 - (53%) Gaps:14/187 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGQTVPNFEADTTKG----PIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTK 63
            :|...|:|||:....    .:|..|:.|..:|:||.:|.|||.||.||:...:....||.|.||:
plant    82 VGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTE 146

  Fly    64 CLAHSVDALNSHVDWV-NDIKSYCLDIPGDFPYPIIADPTRDLAVSLGMLDEEQKKDPEVGKTIR 127
            .|..|||::.||:.|| .|.||..|   ||..||:::|.|:.::.|.|:|      .|:.|..:|
plant   147 VLGVSVDSVFSHLAWVQTDRKSGGL---GDLNYPLVSDITKSISKSFGVL------IPDQGIALR 202

  Fly   128 ALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVM 184
            .||||..:..::.|....:..||:|||.:||:.:||..........||.|.||.|.|
plant   203 GLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 69/187 (37%)
PRX_1cys 3..218 CDD:239314 69/187 (37%)
2-Cys Prx BNP_568166.1 PRX_Typ2cys 82..255 CDD:239313 65/181 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.