DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and prdx4

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001082894.1 Gene:prdx4 / 570477 ZFINID:ZDB-GENE-030131-1096 Length:260 Species:Danio rerio


Alignment Length:215 Identity:64/215 - (29%)
Similarity:103/215 - (47%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLGQTVPNFEADTTKG----PIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNT 62
            ::.:..|::|......    .:|..:::| .::|.|.:|.|||.||.||:...:....||...|.
Zfish    69 KISKPAPHWEGTAVINGEFKELKLSDYKG-KYLVFFFYPLDFTFVCPTEIIAFSDRVHEFQAINA 132

  Fly    63 KCLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVSLGMLDEEQKKDPE 121
            :.:|.|||:..:|:.|:|        .|      |....|:::|.|..::...|:..|:|     
Zfish   133 EVVACSVDSQFTHLAWIN--------TPRKQGGLGPMKIPLLSDLTHQISKDYGVFLEDQ----- 184

  Fly   122 VGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMIL 186
             |.|:|.||||.....:|......:..||:|||.||.:.:.|.||:...|. ||.|.||:     
Zfish   185 -GHTLRGLFIIDGKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVC-PAGWKPGS----- 242

  Fly   187 PTVTDEEAHKLFPKGFDKVS 206
            .|:..:.|.||  |.|||::
Zfish   243 DTIIPDPAGKL--KYFDKLN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 57/201 (28%)
PRX_1cys 3..218 CDD:239314 64/214 (30%)
prdx4NP_001082894.1 PTZ00253 68..256 CDD:140280 61/209 (29%)
PRX_Typ2cys 70..241 CDD:239313 54/186 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.