DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and Jafrac1

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster


Alignment Length:181 Identity:62/181 - (34%)
Similarity:90/181 - (49%) Gaps:23/181 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVNDIK 83
            ||..:::| .::|||.:|.|||.||.||:...:....||.|.|.:.:..|.|:..:|:.|:|   
  Fly    24 IKLSDYKG-KYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWIN--- 84

  Fly    84 SYCLDIP------GDFPYPIIADPTRDLAVSLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSM 142
                 .|      |....|::||.:..:|...|:|||      |.|...|.||||.....:|...
  Fly    85 -----TPRKQGGLGSMDIPLLADKSMKVARDYGVLDE------ETGIPFRGLFIIDDKQNLRQIT 138

  Fly   143 FYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMIL-PTVTDE 192
            ...:..||:|:|.||.:.:.|.||:...|. ||||.||.|.|:. ||.:.|
  Fly   139 VNDLPVGRSVEETLRLVQAFQYTDKYGEVC-PANWKPGQKTMVADPTKSKE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 62/181 (34%)
PRX_1cys 3..218 CDD:239314 62/181 (34%)
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 55/166 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.