DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and Jafrac2

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster


Alignment Length:208 Identity:65/208 - (31%)
Similarity:94/208 - (45%) Gaps:29/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGQTVPNFE--ADTTKGPIK--FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTK 63
            :.:..|.||  |...|..:|  ..::.| .:|||..:|.|||.||.||:...:....||.|..|:
  Fly    52 ISKPAPQFEGTAVVNKEIVKLSLSQYLG-KYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTE 115

  Fly    64 CLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVSLGMLDEEQKKDPEV 122
            .:..|||:..:|:.|:|        .|      ||...|:::|.|..::...|:..|..      
  Fly   116 VIGVSVDSHFTHLAWIN--------TPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESS------ 166

  Fly   123 GKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILP 187
            |..:|.||||.....:|......:..||:|||.:|.:.:.|.||....|. ||.|.||... |:|
  Fly   167 GHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVC-PAGWRPGADT-IVP 229

  Fly   188 TVTDEEAHKLFPK 200
              ..||..|.|.|
  Fly   230 --NPEEKTKYFAK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 61/200 (31%)
PRX_1cys 3..218 CDD:239314 65/208 (31%)
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 56/186 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.