DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and prdx4

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001006812.1 Gene:prdx4 / 448526 XenbaseID:XB-GENE-976761 Length:271 Species:Xenopus tropicalis


Alignment Length:238 Identity:68/238 - (28%)
Similarity:100/238 - (42%) Gaps:62/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GQTVPNFEADTTKGPIKFHE--------------WQGNS-----------------WVVLFSHPA 37
            ||..|   .:.|:.|:..|.              |:|.:                 ::|.|.:|.
 Frog    57 GQVYP---GEATRVPVSDHSLHLSKAKISKPAPYWEGTAVINGEFKELKLTDYKGKYLVFFFYPL 118

  Fly    38 DFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYP 96
            |||.||.||:........||...||:.:|.|||:..:|:.|:|        .|      |....|
 Frog   119 DFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWIN--------TPRKQGGLGPMKIP 175

  Fly    97 IIADPTRDLAVSLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDS 161
            :::|.|..::...|:..|:|      |.|:|.||||.....:|......:..||:|||.||.:.:
 Frog   176 LLSDLTHQISKDYGVYLEDQ------GHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQA 234

  Fly   162 LQLTDRLKVVATPANWTPGTKVMILPTVTDEEAHKLFPKGFDK 204
            .|.||....|. ||.|.||::     |:..:.|.||  |.|.|
 Frog   235 FQYTDTHGEVC-PAGWKPGSE-----TIIPDPAGKL--KYFHK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 62/226 (27%)
PRX_1cys 3..218 CDD:239314 68/238 (29%)
prdx4NP_001006812.1 PRX_Typ2cys 81..252 CDD:239313 53/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.