DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and prdx6

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_989102.1 Gene:prdx6 / 394706 XenbaseID:XB-GENE-951731 Length:224 Species:Xenopus tropicalis


Alignment Length:216 Identity:121/216 - (56%)
Similarity:151/216 - (69%) Gaps:2/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAH 67
            ||:..|:||||||.|.|||||:.|.||.||||||.|:||||||||||.....|||.|||.:.:|.
 Frog     6 LGEIFPDFEADTTIGRIKFHEFLGGSWGVLFSHPRDYTPVCTTELGRCVKLAPEFKKRNVRMIAL 70

  Fly    68 SVDALNSHVDWVNDIKSYCLDIPGD-FPYPIIADPTRDLAVSLGMLDEEQKKDPEVGKTIRALFI 131
            |:|::..|:.|..||.||..|.|.: .|:||||||.|||||.|||||.::|....:..|.|.:||
 Frog    71 SIDSVEDHLGWSKDINSYNCDEPTETLPFPIIADPKRDLAVKLGMLDPDEKDMQGMPVTARCVFI 135

  Fly   132 ISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTDEEAHK 196
            |.||.|::||:.||.:||||.|||||.:|||||| .:..||||.:|.||.:||:.|.|.:|||.|
 Frog   136 IGPDKKMKLSILYPATTGRNFDEILRVVDSLQLT-AVHNVATPVDWKPGDRVMVPPNVPEEEASK 199

  Fly   197 LFPKGFDKVSMPSGVNYVRTT 217
            |:|.|....::||..||:|.|
 Frog   200 LYPSGVFNKALPSRKNYLRYT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 109/191 (57%)
PRX_1cys 3..218 CDD:239314 121/216 (56%)
prdx6NP_989102.1 PRX_1cys 6..220 CDD:239314 120/214 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I4098
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60653
OrthoDB 1 1.010 - - D1129256at2759
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43503
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1721
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.