DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and prdx-2

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001300536.1 Gene:prdx-2 / 266858 WormBaseID:WBGene00006434 Length:201 Species:Caenorhabditis elegans


Alignment Length:202 Identity:65/202 - (32%)
Similarity:101/202 - (50%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGQTVPNFE----ADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTK 63
            :|:..|.|:    .|.....:...:::| .:||||.:|.|||.||.||:...:....||...||.
 Worm    12 IGKPAPQFKTQAVVDGEFVDVSLSDYKG-KYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTV 75

  Fly    64 CLAHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIADPTRDLAVSLGMLDEEQKKDPEVGKTIRA 128
            .||.|.|::.||:.|:|..:.:  ...|:...|::||....::...|:|.|::      |...|.
 Worm    76 VLAASTDSVFSHLAWINQPRKH--GGLGEMNIPVLADTNHQISRDYGVLKEDE------GIAFRG 132

  Fly   129 LFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTDEE 193
            ||||.|...:|......:..||:|||.||.:.:.|..::...|. ||.||||:.. |.|.|  :|
 Worm   133 LFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVC-PAGWTPGSDT-IKPGV--KE 193

  Fly   194 AHKLFPK 200
            :.:.|.|
 Worm   194 SQEYFKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 62/194 (32%)
PRX_1cys 3..218 CDD:239314 65/202 (32%)
prdx-2NP_001300536.1 PRX_Typ2cys 12..183 CDD:239313 57/180 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.