DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and tpx1

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_588430.1 Gene:tpx1 / 2539572 PomBaseID:SPCC576.03c Length:192 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:61/210 - (29%)
Similarity:98/210 - (46%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLGQTVPNFEADTTKG----PIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRN 61
            :::|:..|:|:......    .||..:::| .||.|..:|.|||.||.||:...:....:||:||
pombe     3 LQIGKPAPDFKGTAVVNGAFEEIKLADYKG-KWVFLGFYPLDFTFVCPTEIVAFSEAASKFAERN 66

  Fly    62 TKCLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVSLGMLDEEQKKDP 120
            .:.:..|.|:..||:.::|        .|      |....|::|||:..::...|:|.|      
pombe    67 AQVILTSTDSEYSHLAFIN--------TPRKEGGLGGINIPLLADPSHKVSRDYGVLIE------ 117

  Fly   121 EVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMI 185
            :.|...|.||:|.|...:|......:..||:|||.||.:|:.|..:....|. ||||..|:    
pombe   118 DAGVAFRGLFLIDPKGVLRQITINDLPVGRSVDEALRLLDAFQFVEEHGEVC-PANWHKGS---- 177

  Fly   186 LPTVTDEEAHKLFPK 200
             .|:..:...|.|.|
pombe   178 -DTIDTKNPEKYFSK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 58/202 (29%)
PRX_1cys 3..218 CDD:239314 61/208 (29%)
tpx1NP_588430.1 AhpC 1..192 CDD:223527 61/210 (29%)
PRX_Typ2cys 5..176 CDD:239313 56/186 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.