DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and Prdx6

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_031479.1 Gene:Prdx6 / 11758 MGIID:894320 Length:224 Species:Mus musculus


Alignment Length:216 Identity:116/216 - (53%)
Similarity:149/216 - (68%) Gaps:2/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAH 67
            ||...|||||:||.|.|:||::.|:||.:|||||.||||||||||||.|...|||||||.|.:|.
Mouse     7 LGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIAL 71

  Fly    68 SVDALNSHVDWVNDIKSYCLDIPGD-FPYPIIADPTRDLAVSLGMLDEEQKKDPEVGKTIRALFI 131
            |:|::..|:.|..||.:|..:.|.: .|:|||.|..||||:.|||||..:|....:..|.|.:||
Mouse    72 SIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDANNMPVTARVVFI 136

  Fly   132 ISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTVTDEEAHK 196
            ..||.|::||:.||.:||||.|||||.:||||||. .|.||||.:|..|..||::||:::|||.:
Mouse   137 FGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTG-TKPVATPVDWKKGESVMVVPTLSEEEAKQ 200

  Fly   197 LFPKGFDKVSMPSGVNYVRTT 217
            .||||.....:|||..|:|.|
Mouse   201 CFPKGVFTKELPSGKKYLRYT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 104/191 (54%)
PRX_1cys 3..218 CDD:239314 116/216 (54%)
Prdx6NP_031479.1 PRX_1cys 7..222 CDD:239314 116/216 (54%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000250|UniProtKB:O35244 31..40 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835450
Domainoid 1 1.000 151 1.000 Domainoid score I4332
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S632
OMA 1 1.010 - - QHG60653
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - O PTHR43503
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1721
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.660

Return to query results.
Submit another query.