DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx2540-2 and PRDX3

DIOPT Version :9

Sequence 1:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_006784.1 Gene:PRDX3 / 10935 HGNCID:9354 Length:256 Species:Homo sapiens


Alignment Length:212 Identity:62/212 - (29%)
Similarity:97/212 - (45%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QTVPNFEAD-TTKGPIK---FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCL 65
            |..|.|:.. ...|..|   ..:::| .::|||.:|.|||.||.||:...:....||...|.:.:
Human    67 QHAPYFKGTAVVNGEFKDLSLDDFKG-KYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVV 130

  Fly    66 AHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVSLGMLDEEQKKDPEVGK 124
            |.|||:..||:.|:|        .|      |.....:::|.|:.::...|:|.|..      |.
Human   131 AVSVDSHFSHLAWIN--------TPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGS------GL 181

  Fly   125 TIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTV 189
            .:|.||||.|:..::......:..||:|:|.||.:.:.|..:....|. ||||||.:     ||:
Human   182 ALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVC-PANWTPDS-----PTI 240

  Fly   190 TDEEAHKLFPKGFDKVS 206
            ....|..  .:.|.||:
Human   241 KPSPAAS--KEYFQKVN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 58/198 (29%)
PRX_1cys 3..218 CDD:239314 62/212 (29%)
PRDX3NP_006784.1 PRX_Typ2cys 65..236 CDD:239313 55/184 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.