DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG14518

DIOPT Version :9

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:128 Identity:30/128 - (23%)
Similarity:51/128 - (39%) Gaps:35/128 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YVEY----FRKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRIF----YKMENIKGCDFL---N 76
            :||:    .|.|...|:........|.|...:.:..:::|....:    |.: :..||.|:   |
  Fly    39 WVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKPWLYSV-SFDGCQFIRRRN 102

  Fly    77 NPL------LFKMFGEVYNHLVVNGSYFKCPI----KPKVYYLKNEGTVSIIPSIHPPGRFQL 129
            |.|      |||.:..: ||        .||.    :.|.:||::|.    :|:..|.|.:.|
  Fly   103 NALIRIVWELFKEYSTI-NH--------TCPYVGLQQVKNFYLRSEK----LPTPIPTGEYLL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 22/97 (23%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.