DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33467

DIOPT Version :9

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:97 Identity:18/97 - (18%)
Similarity:28/97 - (28%) Gaps:42/97 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FTIDITVKV-------------VKTQRIFYKMENIKGCDFLNNPLLFKMFGEVYNHLVVNGSYFK 99
            |.||.|.|:             |....:|.:..|:|.|             .:...|.....|..
  Fly    86 FLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVKSC-------------HISGQLSARNGYLN 137

  Fly   100 CPIKPKVYYLKNEGTVSIIPSIHPPGRFQLSM 131
            .               |.:|.. |.|::|:|:
  Fly   138 S---------------SYVPPF-PHGQYQISV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 16/93 (17%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 16/93 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.