DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33475

DIOPT Version :9

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:141 Identity:45/141 - (31%)
Similarity:75/141 - (53%) Gaps:1/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LETNCDHDYVEYFRKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRIFYKMENIKGCDFLNNPL 79
            ||...:...|:||..||...........||.....:|..::...:.|..|.::|:..|:||||.|
  Fly     8 LELKYNRSNVDYFGLVPGESQKMMINSTKLFKNIFLDNRIQNAVSNRTIYNIKNLAICNFLNNRL 72

  Fly    80 LFKMFGEVYNHLVVNGSYFKCPIKPKVYYLKNEGTVSIIPSIHPPGRFQLSMRVRMAESRAPFVM 144
            :.|::..:|...|.|.:.|:||::|.||||.|......:|..|.||.|:|.:::: ||.....:.
  Fly    73 ISKVYSVIYEGFVGNSTVFRCPVQPSVYYLSNSVREFEVPIFHQPGMFRLYVKLK-AEKEGNMLT 136

  Fly   145 EMLWKYKIVRI 155
            |::|:|::.||
  Fly   137 ELIWRYRVRRI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 28/80 (35%)
CG33475NP_995799.1 DUF1091 54..122 CDD:284008 27/67 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449924
Domainoid 1 1.000 45 1.000 Domainoid score I19322
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014251
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.