DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fgfrl1 and btl

DIOPT Version :9

Sequence 1:NP_954545.1 Gene:Fgfrl1 / 360903 RGDID:735156 Length:529 Species:Rattus norvegicus
Sequence 2:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster


Alignment Length:571 Identity:150/571 - (26%)
Similarity:212/571 - (37%) Gaps:166/571 - (29%)


- Green bases have known domain annotations that are detailed below.


  Rat    33 PRQVA-RLGRTVRLQCPVEGD--PPPLTMWTKDGR--TIHSGWSRFRVL---------------- 76
            ||..: .||..|.::|.:|..  .|.:| |...|.  .|.....|.|..                
  Fly   247 PRNTSIALGDNVSIECLLEDSALEPKIT-WLHKGNADNIDDLLQRLREQSQLPVDVTRLITRMDE 310

  Rat    77 PQGLKVKEVEAEDAGVYVCKATNGFG-SLSVNYTLIIMDDISPGK------------ENPGPGGS 128
            ||.|::..|..||.|.|:|.|.|..| :::.:|    :|..||..            .:|.|..|
  Fly   311 PQVLRLGNVLMEDGGWYICIAENQVGRTVAASY----VDLYSPSDTTTVRTTTTTTVASPIPTAS 371

  Rat   129 SG-GQEDPVSQQWAR-------PRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQ 185
            :| ..:|.|....|.       |.|.:..|..:..::   |::|.|.|...|  :.:|.|.||.:
  Fly   372 TGEDNDDDVENPAAEASGGVGPPVFRKELKRLQHSLS---GNTVNLACPVYG--KANITWTKDKK 431

  Rat   186 TLTRLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPV 250
            .|.| |...:.:|.|||.......||||.|.|:|.|..|.|...:.|.:..||||.|::  ..|.
  Fly   432 PLNR-ELGVYVQKNWTLRFVEATSEDSGLYNCKVCNAWGCIQFDFSVQINDRTRSAPII--VVPQ 493

  Rat   251 NTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSY 315
            |.||...|:...:|.|.||:.|.:.| |||..     .|:::|  |.|.|.:...:.....|...
  Fly   494 NQTVKVNGSLVMKCTVYSDLHPTVSW-KRVVL-----KNASLD--GLKSVEIQNLNFTVTNDSVV 550

  Rat   316 LNKLLISRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPV-------AHSSSTTSLPW 373
            |.   :.....|..|.|.||.::.:|.|..|.:|.|:    .|.||:       ||....|....
  Fly   551 LT---LRNVTFDQEGWYTCLASSGLGRSNSSVYLRVV----SPLPPLEIYALLHAHPLGFTLAAI 608

  Rat   374 PVVIGIPAGAVFI----------------LGTVLLWLCQTKKKPCAPASTLPVPGHRPPGT--SR 420
            .:|.....|:.||                :.||..|   |||          |..:||.|.  |.
  Fly   609 TIVALFLLGSAFITFMLRRLRREKLLKLRIETVHQW---TKK----------VIIYRPGGEEGSG 660

  Rat   421 ERSGDKDLPSLAVGICEEHGSTMAPQHILAPGSTAGPKLYPKLYTDVHTHTHTHTCTHTLSCGG- 484
            ..|||..:|.:.:   |:..:|:         ||.|                         .|| 
  Fly   661 CSSGDLQMPVIRI---EKQRTTV---------STTG-------------------------TGGT 688

  Rat   485 ---QGSSAPACPLSVLNTANLQALCPEVGVWGPRQQ--VGRIENNG--GRV 528
               ||.:....||.    :|.:.         ||||  :|.|...|  |||
  Fly   689 DPAQGFNEYEFPLD----SNWEI---------PRQQLSLGSILGEGAFGRV 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fgfrl1NP_954545.1 I-set 29..112 CDD:400151 27/100 (27%)
Ig strand A' 35..38 CDD:409353 0/3 (0%)
Ig strand B 41..50 CDD:409353 2/8 (25%)
Ig strand C 56..61 CDD:409353 2/4 (50%)
Ig strand C' 64..67 CDD:409353 0/4 (0%)
Ig strand D 72..77 CDD:409353 2/20 (10%)
Ig strand E 78..84 CDD:409353 2/5 (40%)
Ig strand F 91..99 CDD:409353 4/7 (57%)
Ig strand G 102..112 CDD:409353 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..152 12/54 (22%)
IgI_2_FGFRL1-like 143..234 CDD:409442 30/90 (33%)
Ig strand B 164..168 CDD:409442 2/3 (67%)
Ig strand C 177..181 CDD:409442 1/3 (33%)
Ig strand E 200..204 CDD:409442 3/3 (100%)
Ig strand F 214..219 CDD:409442 2/4 (50%)
Ig strand G 227..230 CDD:409442 0/2 (0%)
Ig 242..350 CDD:416386 30/107 (28%)
Ig strand A 242..245 CDD:409353 1/2 (50%)
Ig strand A' 249..253 CDD:409353 2/3 (67%)
Ig strand B 261..268 CDD:409353 2/6 (33%)
Ig strand C 272..279 CDD:409353 2/6 (33%)
Ig strand D 304..309 CDD:409353 0/4 (0%)
Ig strand E 317..322 CDD:409353 0/4 (0%)
Ig strand F 330..338 CDD:409353 4/7 (57%)
Ig strand G 341..349 CDD:409353 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427 8/23 (35%)
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652 25/89 (28%)
Ig 258..340 CDD:143165 22/82 (27%)
I-set 394..479 CDD:254352 30/90 (33%)
IGc2 408..469 CDD:197706 24/66 (36%)
IG_like 492..583 CDD:214653 30/101 (30%)
Ig 507..583 CDD:299845 25/86 (29%)
PKc_like 700..1000 CDD:304357 13/40 (33%)
TyrKc 712..996 CDD:197581 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.