DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12909 and YCR087C-A

DIOPT Version :9

Sequence 1:NP_610573.1 Gene:CG12909 / 36087 FlyBaseID:FBgn0033507 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_010011.1 Gene:YCR087C-A / 850449 SGDID:S000007223 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:64/277 - (23%)
Similarity:86/277 - (31%) Gaps:130/277 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFFTCNICGESVKKPAVEKHYQTRCRGKDKNVSCMDCLKDFY-GEEYVAHIKCISEAQKYASQS 64
            ||.|.|.:|.::|.|...||||. ||  .:...:|:||.|.|. |..|..|..||||.:||    
Yeast     1 MVTFNCEVCNDTVPKKNTEKHYY-RC--PNAYYTCIDCSKTFEDGVSYKNHTSCISEDEKY---- 58

  Fly    65 QGFAAKEPRNKNAQKQESWMDIIRSILDSSEYNLTPAVRSAFQKLQSVDNVPRKKAKFENFVGNC 129
                                                                 :||.::.     
Yeast    59 -----------------------------------------------------QKALYKG----- 65

  Fly   130 MRMPRNQATQVWDILEKELNKMKEAKQAELARAKAEKIAEIQQKQKAEVEEEAPPKKKAKVETTE 194
                               ||.::.||.:          :.||||........|.||..|....:
Yeast    66 -------------------NKKQKQKQQQ----------KQQQKQHQHQPVATPAKKVEKPVIKK 101

  Fly   195 DAAAEETSNGVTSDFDWAAQLTKIVTKQADGIFLEKLRKKLLKKYAKHLSVEDLNEKQAKKFQKR 259
            ....|:||||:        :|.|       |..|.|:.|.:..|.||                |.
Yeast   102 AEKVEKTSNGI--------ELHK-------GKSLYKILKTMKDKGAK----------------KT 135

  Fly   260 FDKQLKLADSLEVEGEI 276
            |.|.| :.||   ||:|
Yeast   136 FLKSL-VVDS---EGQI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12909NP_610573.1 zf-LYAR 33..60 CDD:285943 12/27 (44%)
YCR087C-ANP_010011.1 zf-LYAR 30..58 CDD:400924 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005214
OrthoInspector 1 1.000 - - oto100119
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13100
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1863
SonicParanoid 1 1.000 - - X3728
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.