DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12909 and AT2G19385

DIOPT Version :9

Sequence 1:NP_610573.1 Gene:CG12909 / 36087 FlyBaseID:FBgn0033507 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_565451.1 Gene:AT2G19385 / 816457 AraportID:AT2G19385 Length:275 Species:Arabidopsis thaliana


Alignment Length:303 Identity:80/303 - (26%)
Similarity:136/303 - (44%) Gaps:52/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFFTCNICGESVKKPAVEKHYQTRCRGKDKNVSCMDCLKDFYGEEYVAHIKCISEAQKYASQSQ 65
            ||:|.|..||||:|||.|..|:: .||.  ..:||:||.:.|..:....|.:||:||:||..:.|
plant     1 MVWFQCEDCGESLKKPKVPSHFK-MCRA--NKLSCIDCGEMFGRDTVQGHNQCITEAEKYGPKGQ 62

  Fly    66 GFAAK--EPRNKNAQKQESWMDIIRSILDSSEY----NLTPAVRSAFQKLQSVDNVPRKKAKFEN 124
            ..:|.  ..:.|:..|||...||  ::..|:.|    :|.....::.|.|.:..:..:.:.|.:.
plant    63 SKSANGTPAKPKDISKQEPDFDI--NVGLSNRYPWFCSLCNTKATSQQTLLAHADGKKHRGKAKA 125

  Fly   125 FVGNCMRMPRNQATQV--WDILEKELNKMKEAKQAELARAKAEKIAEIQQKQKAEVEEEAPPKKK 187
            |..   |..:.|:|.:  .|..|...|...|.|:.:|..:            ......|:.|:||
plant   126 FHA---RQQQEQSTTLDNKDGSENASNVDSEQKKVDLPAS------------SGVANGESHPEKK 175

  Fly   188 AKVETTEDAAAEETSNGVTSD------------FDWAAQLTKIVTKQADGIFLEKLRKKLLKKYA 240
            .|:||.::.:..|.:.|  ||            .:|...:|..:....|    :.|:.|.|||  
plant   176 RKLETLDETSEGEEAKG--SDLKKAKKQDHEKKINWKKLITSALKSNED----KTLKMKKLKK-- 232

  Fly   241 KHLSVEDLNEKQAKKFQKRFDKQLK--LADSLEVEGEIVKIAS 281
              |.:|.:.:....|.:.:.:.:||  |:....|:|:.||:.:
plant   233 --LVLESIVDSGRDKSELKAELELKVNLSSRFTVDGKYVKLVA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12909NP_610573.1 zf-LYAR 33..60 CDD:285943 10/26 (38%)
AT2G19385NP_565451.1 zf-LYAR 30..57 CDD:400924 10/26 (38%)
zf-met 95..119 CDD:403930 3/23 (13%)
PRP11 <97..>167 CDD:227571 14/84 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2424
OMA 1 1.010 - - QHG58202
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005214
OrthoInspector 1 1.000 - - otm3318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13100
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3728
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
99.020

Return to query results.
Submit another query.