DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12909 and AT2G19380

DIOPT Version :9

Sequence 1:NP_610573.1 Gene:CG12909 / 36087 FlyBaseID:FBgn0033507 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_565450.1 Gene:AT2G19380 / 816456 AraportID:AT2G19380 Length:613 Species:Arabidopsis thaliana


Alignment Length:402 Identity:84/402 - (20%)
Similarity:146/402 - (36%) Gaps:143/402 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFFTCNICGESVKKPAVEKHYQTRCRGKDKNVSCMDCLKDFYGEEYV-AHIKCISEAQKYAS-- 62
            ||:|.|:.|||::|||.:.:| .:.|..  ...||:|| .:.:|:..| .|.:||:||:||..  
plant     1 MVWFQCDDCGENLKKPRLPRH-MSMCTA--TKFSCIDC-GNMFGQVSVHYHNQCITEAEKYGPMV 61

  Fly    63 QSQGFAAKEPR------------------------------------------------------ 73
            :|.|.::|:..                                                      
plant    62 RSNGESSKQKHDFDINAELFNSQWFCSLCNATMTCEQDYFAHVYGKKHQEKANEVADMDYSKQQS 126

  Fly    74 -----NKNAQKQESWMDIIRSILDSSEY----NLTPAVRSAFQKLQSVDNVPRKKAKFENFVGNC 129
                 :||...|:..:||...:  |::|    :|.....::.|.|.:..|..:.:.|.|.|..  
plant   127 EHPAVDKNNLTQQPDLDIYVGL--SNDYPWFCSLCDINATSEQTLLAHANGKKHRVKVERFDA-- 187

  Fly   130 MRMPRNQATQVWDILEKELNK-----------------------MKEAKQAEL-----ARAKAEK 166
             ...:.|:||...:.:|:.:|                       :|...|..|     .|...|.
plant   188 -EQQKRQSTQHSTVDKKDYSKQQIEVDINVGLSNCYPWFCSLCNVKATCQQNLLSHANGRKHREN 251

  Fly   167 IAEIQQKQKAEVEEEAPPKKKAKVETTEDAAAEE-----TSNGVTSDFDWAAQLTKIVT------ 220
            :......|:.::|:....||...|..::..:.::     .|:||.:.:..|.:..|:.|      
plant   252 VELFDATQQQQLEKTTVDKKDTTVNASDGNSEQKKVDLLVSSGVANGYSQAHKKRKLETCDETWK 316

  Fly   221 ------KQADGIFLEKLRKKLLKKYAKHLSVEDLNEKQAKKFQKR------FD------KQLKLA 267
                  ::|.|...:|...|..||..|        ||:.||.:|:      |:      |||.:|
plant   317 REVVQAEEAKGGGEQKSESKKAKKQDK--------EKKRKKDKKQTKSDSDFEHDKEDIKQLLVA 373

  Fly   268 DSLEVEGEIVKI 279
            .|.|   |:|.:
plant   374 YSKE---ELVNL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12909NP_610573.1 zf-LYAR 33..60 CDD:285943 11/27 (41%)
AT2G19380NP_565450.1 zf-LYAR 30..57 CDD:285943 11/27 (41%)
ZnF_U1 83..116 CDD:197732 0/32 (0%)
ZnF_U1 151..185 CDD:197732 7/33 (21%)
ZnF_U1 221..255 CDD:197732 5/33 (15%)
RRM_SF 408..483 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2424
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3318
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.