DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12909 and lyar

DIOPT Version :9

Sequence 1:NP_610573.1 Gene:CG12909 / 36087 FlyBaseID:FBgn0033507 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_956973.2 Gene:lyar / 393652 ZFINID:ZDB-GENE-040426-1414 Length:320 Species:Danio rerio


Alignment Length:329 Identity:94/329 - (28%)
Similarity:162/329 - (49%) Gaps:61/329 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFFTCNICGESVKKPAVEKHYQTRCRGKDKNVSCMDCLKDFYGEEYVAHIKCISEAQKYASQSQ 65
            ||||||:.||||:||..||||. .:||.... :||:||..||.|::|.:|.:||||.|||..:. 
Zfish     1 MVFFTCDGCGESLKKAQVEKHL-LKCRSCHV-LSCIDCGADFRGDDYKSHNRCISEDQKYGGRD- 62

  Fly    66 GFAAKEPRNKNAQKQESWMDIIRSILDSSEYNLTPAVRSAFQKLQSVDNVPRKKAKFENFVGNCM 130
             |.|:  .||...||:.|::.::..:  |..::...::...::|...:|||||||||||::.||:
Zfish    63 -FQAR--ANKGDLKQQQWIERVQEAV--SRPDVGSELQQVLRRLSVYENVPRKKAKFENWMRNCL 122

  Fly   131 RM-PRNQATQVWDIL-------------------------------EKELNKMKEAKQAELARAK 163
            :: ..:...|||:||                               |::..|.|:.|..:.:..:
Zfish   123 KIHSPHLLKQVWEILSTAADSNGKPASRETTENCESRTDLKNGTEEEEDQRKKKKKKNRKTSEEQ 187

  Fly   164 --AEKIAEIQQKQKAEVEEEAPPK-----KKAKVETTEDAAAEE---------TSNGVTSDFDWA 212
              .||..:.|::::.:.|:....|     ||:|.|..:::..||         ..|.....|:|.
Zfish   188 NGHEKHTQKQKRKREQNEQNTDGKNNKRQKKSKQEEPDESLNEEGEEPDNQETEPNSTAGKFNWK 252

  Fly   213 AQLTKIVTKQA--DGIFLEKLRKKLLKKYAKHLSVEDLNEKQAKKFQKRFDKQLKLADSLEVEGE 275
            ..: |.|.:.|  :|:.::|||||:|..|.....  |.|.:..::....|::::......::..:
Zfish   253 GTI-KAVLRDAPEEGLAVKKLRKKVLAAYYSFSG--DRNYRSEEELLSLFNRKINTNPKFKILKD 314

  Fly   276 IVKI 279
            .|::
Zfish   315 RVRL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12909NP_610573.1 zf-LYAR 33..60 CDD:285943 14/26 (54%)
lyarNP_956973.2 zf-LYAR 31..58 CDD:285943 14/26 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587942
Domainoid 1 1.000 55 0.976 Domainoid score I11085
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5438
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005214
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106568
Panther 1 1.100 - - LDO PTHR13100
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3728
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.