DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12909 and Lyar

DIOPT Version :9

Sequence 1:NP_610573.1 Gene:CG12909 / 36087 FlyBaseID:FBgn0033507 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_079557.2 Gene:Lyar / 17089 MGIID:107470 Length:388 Species:Mus musculus


Alignment Length:372 Identity:108/372 - (29%)
Similarity:159/372 - (42%) Gaps:133/372 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFFTCNICGESVKKPAVEKHYQTRCRGKDKNVSCMDCLKDFYGEEYVAHIKCISEAQKYASQSQ 65
            |||||||.|||||||..||||. :.||..: .:||:||.|||:|::|.:|:|||||.|||.  .:
Mouse     1 MVFFTCNACGESVKKIQVEKHV-SNCRNCE-CLSCIDCGKDFWGDDYKSHVKCISEGQKYG--GK 61

  Fly    66 GFAAKEPRNKNAQKQESWMDIIRSILDSSEYNLTPAVRSAFQKLQSVDNVPRKKAKFENFVGNCM 130
            |:.||  .:|...||::|:..|..::  .:.|::|.||...|::.:.||||||||||:|::.|.:
Mouse    62 GYEAK--THKGDAKQQAWIQKINELI--KKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMKNSL 122

  Fly   131 RMPRNQA-TQVWDIL----------------------EKELNKMKEAK-------QAELARAKAE 165
            ::..:.. .|||||.                      |..:.|:..||       |.|..:.|.|
Mouse   123 KVHSDSVLEQVWDIFSEASSSEQDQQQPPSHTAKPHAEMPITKVPSAKTNGTTEEQTEAKKNKRE 187

  Fly   166 KIAEIQQKQKAEVEE------------EAPPKKKAKVETTEDAAAEETS---------------- 202
            :..|.|:.:|.|.:|            :.|.|:|...|...:||.||.:                
Mouse   188 RKEERQKNRKKEKKELKLENHQENLRGQKPKKRKKNQEAGHEAAGEEAAEASGPPEKKKAQGGQA 252

  Fly   203 ---------------------------------------------------NGVTSD-------- 208
                                                               .|...|        
Mouse   253 SEEGADRNGGPGEDAAEGQTKTAAGKRKRPKHSGAESGYKKKKMKLPEQPEEGEAKDHEAPSKGK 317

  Fly   209 FDWAAQLTKIVTKQA--DGIFLEKLRKKLLKKY-----AKHLSVEDL 248
            |:|...: |.|.|||  :.|.::||:||::.:|     ..|.|.|:|
Mouse   318 FNWKGTI-KAVLKQAPDNEISVKKLKKKVIAQYHAVMNDHHTSEEEL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12909NP_610573.1 zf-LYAR 33..60 CDD:285943 16/26 (62%)
LyarNP_079557.2 zf-ACC 3..28 CDD:375379 18/25 (72%)
zf-LYAR 31..58 CDD:370125 16/26 (62%)
InfB 122..>300 CDD:392272 26/177 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..318 23/177 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843051
Domainoid 1 1.000 66 1.000 Domainoid score I9983
eggNOG 1 0.900 - - E1_KOG2186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4529
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005214
OrthoInspector 1 1.000 - - oto94744
orthoMCL 1 0.900 - - OOG6_106568
Panther 1 1.100 - - LDO PTHR13100
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1863
SonicParanoid 1 1.000 - - X3728
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.